H00132241-M02 RPL32P3 antibody

See related secondary antibodies

Search for all "RPL32P3"

0.1 mg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human RPL32P3 1D5

H00132241-M02

Product Description for RPL32P3

Mouse anti Human RPL32P3 1D5.
Product is tested for Enzyme Immunoassay.

Properties for RPL32P3

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms -
Reactivity Hu
Applications E
Clonality Monoclonal
Clone 1D5
Host Mouse
Isotype IgG2a
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
RPL32P3 (AAH53996.1, 1 a.a. ~ 33 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MAALRSLVKPKIVKKRTKKFIRHQSDRYVKIKR
GeneID:
132241
Add. information Mouse monoclonal antibody raised against a full-length recombinant RPL32P3.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody Reactive Against Recombinant Protein.

Accessory Products

  • LinkedIn