discontinued

H00055197-B01 RPRD1A antibody

See related secondary antibodies

Search for all "RPRD1A"

Quick Overview

Mouse anti Human RPRD1A

H00055197-B01

More Views

  • H00055197-B01
  • H00055197-B01

Product Description for RPRD1A

Mouse anti Human RPRD1A.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for RPRD1A

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Cyclin-dependent kinase inhibitor 2B-related protein, P15RS, Regulation of nuclear pre-mRNA domain-containing protein 1A, p15INK4B-related protein
Presentation Serum
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96P16
Immunogen:
P15RS (AAH10136.1, 1 a.a. ~ 289 a.a) full-length human protein.
AA Sequence:
MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQNSKRKGPE FTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCS SLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLDKITDKESGERLSKMVEDACMLLADYNG RLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEILDMGVSSNDVVTISIFFLLKINIKP
GeneID:
55197
Remarks:
Gene Accession: BC010136.2
Add. information Mouse polyclonal antibody raised against a full-length human P15RS protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ti,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 55197

Accessory Products

Proteins and/or Positive Controls

Proteins for RPRD1A (7 products)

Catalog No. Species Pres. Purity   Source  

RPRD1A

RPRD1A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

RPRD1A (1-312, His-tag)

RPRD1A Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

RPRD1A (1-312, His-tag)

RPRD1A Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

RPRD1A

RPRD1A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RPRD1A

RPRD1A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RPRD1A

RPRD1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RPRD1A

RPRD1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RPRD1A (1 products)

Catalog No. Species Pres. Purity   Source  

P15RS 293T Cell Transient Overexpression Lysate(Denatured)

P15RS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn