discontinued

H00055197-M02 RPRD1A antibody

See related secondary antibodies

Search for all "RPRD1A"

Quick Overview

Mouse anti Human RPRD1A 1B9

Product Description for RPRD1A

Mouse anti Human RPRD1A 1B9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for RPRD1A

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Cyclin-dependent kinase inhibitor 2B-related protein, P15RS, Regulation of nuclear pre-mRNA domain-containing protein 1A, p15INK4B-related protein
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1B9
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96P16
Immunogen:
P15RS (NP_060640, 76 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENC SSLGSPSEPPQTLDLVRAL*
GeneID:
55197
Remarks:
Gene Accession: NM_018170
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant P15RS.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 55197

Accessory Products

Proteins and/or Positive Controls

Proteins for RPRD1A (7 products)

Catalog No. Species Pres. Purity   Source  

RPRD1A

RPRD1A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

RPRD1A (1-312, His-tag)

RPRD1A Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

RPRD1A (1-312, His-tag)

RPRD1A Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

RPRD1A

RPRD1A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RPRD1A

RPRD1A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RPRD1A

RPRD1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RPRD1A

RPRD1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RPRD1A (1 products)

Catalog No. Species Pres. Purity   Source  

P15RS 293T Cell Transient Overexpression Lysate(Denatured)

P15RS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn