TA336078 RPS13 (Center) antibody

Rabbit Polyclonal Anti-RPS13 Antibody

See related secondary antibodies

Search for all "RPS13"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human RPS13

Product Description for RPS13

Rabbit anti Human RPS13.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RPS13

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 40S ribosomal protein S13
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight RPS13: 17 kDa
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P62277
Immunogen:
Synthetic peptide corresponding to a middle region of human RPS13
AA Sequence:
ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES
GeneID:
6207
Property Center
Application Western blotting (0.2 - 1 µg/ml).
Background Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S15P family of ribosomal proteins. It is located in the cytoplasm. The protein has been shown to bind to the 5.8S rRNA in rat. The gene product of the E. coli ortholog (ribosomal protein S15) functions at early steps in ribosome assembly. This gene is co-transcribed with two U14 small nucleolar RNA genes, which are located in its third and fifth introns. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
General Readings Binding of human ribosomal protein S13 to the central domain of 18S rRNA. Ivanov AV, et al. Mol Biol (Mosk), 2011 Nov-Dec. PMID 22295575.
Storage

Store lyophilized at 2-8°C for one month or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for up to one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
Shelf life: one year from despatch.

Format
Purification:
Immunoaffinity column
State:
Lyophilized from PBS
Aff - Purified
Reconstitution:
Add 50 µl of distilled water to a final concentration of 1 mg/ml.
Species Reactivity
Species reactivity (tested):
Human.

Accessory Products

Proteins and/or Positive Controls

Proteins for RPS13 (4 products)

Catalog No. Species Pres. Purity   Source  

RPS13 (1-151, His-tag)

RPS13 Human Purified > 80 % by SDS - PAGE E. coli
0.5 mg / €940.00
  Acris Antibodies GmbH

RPS13 (1-151, His-tag)

RPS13 Human Purified > 80 % by SDS - PAGE E. coli
0.1 mg / €370.00
  Acris Antibodies GmbH

RPS13

RPS13 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RPS13

RPS13 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RPS13 (1 products)

Catalog No. Species Pres. Purity   Source  

RPS13 overexpression lysate

RPS13 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn