TA334366 RPS4Y2 / RPS4Y2P antibody

Rabbit Polyclonal Anti-RPS4Y2 Antibody

See related secondary antibodies

Search for all "RPS4Y2 / RPS4Y2P"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat RPS4Y2 / RPS4Y2P

Product Description for RPS4Y2 / RPS4Y2P

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat RPS4Y2 / RPS4Y2P.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPS4Y2 / RPS4Y2P

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 40S ribosomal protein S4, Y isoform 2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-RPS4Y2 antibody is: synthetic peptide directed towards the C-terminal region of Human RPS4Y2. Synthetic peptide located within the following region: NGNSFATRISNIFVIGNGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Positive controls for RPS4Y2 / RPS4Y2P (1 products)

Catalog No. Species Pres. Purity   Source  

RPS4Y2 overexpression lysate

RPS4Y2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn