discontinued

NBP1-54904 RUFY1 antibody

See related secondary antibodies

Search for all "RUFY1"

50 µg / €390.00

Quick Overview

Rabbit anti Human, Mouse, Rat RUFY1

Product Description for RUFY1

Rabbit anti Human, Mouse, Rat RUFY1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RUFY1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ22251, RABIP4, ZFYVE12
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8K7B1
Immunogen:
Synthetic peptides corresponding to RUFY1(RUN and FYVE domain containing 1) The peptide sequence was selected from the C terminal of RUFY1. Peptide sequence QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLL.
Background RUFY1 contains 1 FYVE-type zinc finger and 1 RUN domain. It binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in early endosomal trafficking.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn