discontinued

H00000861-M05 RUNX1 antibody

See related secondary antibodies

Search for all "RUNX1"

Quick Overview

Mouse anti Human, Mouse RUNX1 4E7

H00000861-M05

More Views

  • H00000861-M05
  • H00000861-M05
  • H00000861-M05
  • H00000861-M05

Product Description for RUNX1

Mouse anti Human, Mouse RUNX1 4E7.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot, Paraffin Sections.

Properties for RUNX1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms 1, AML-1, AML1, AML1-EVI-1, AMLCR1, Acute myeloid leukemia 1 protein, CBF-alpha-2, CBFA2, Core-binding factor subunit alpha-2, EVI-1, PEA2-alpha B, PEBP2-alpha B, PEBP2A2, Polyomavirus enhancer-binding protein 2 alpha B subunit, Runt-related transcription factor, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit
Presentation Purified
Reactivity Hu, Ms
Applications E, ICC/IF, P, WB
Clonality Monoclonal
Clone 4E7
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q01196
Immunogen:
RUNX1 (NP_001001890, 210 a.a. ~ 311 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTT LSAELSSRLSTAPDLTAFSDPRQFP*
GeneID:
861
Remarks:
Gene Accession: NM_001001890
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant RUNX1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,IHC-P,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 861

Accessory Products

Proteins and/or Positive Controls

Proteins for RUNX1 (3 products)

Catalog No. Species Pres. Purity   Source  

RUNX1 (transcript variant 2)

RUNX1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RUNX1

RUNX1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

RUNX1

RUNX1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Positive controls for RUNX1 (3 products)

Catalog No. Species Pres. Purity   Source  

RUNX1 Lysate

Western Blot: RUNX1 Lysate [NBL1-15624] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RUNX1
  Novus Biologicals Inc.

RUNX1 overexpression lysate

RUNX1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

RUNX1 overexpression lysate

RUNX1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn