
NBP1-69178 RUNX2 antibody

See related secondary antibodies

Search for all "RUNX2"

50 µg / €390.00

Quick Overview

Rabbit anti Rat RUNX2


Product Description for RUNX2

Rabbit anti Rat RUNX2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RUNX2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CBFA1
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to Runx2 (runt-related transcription factor 2) The peptide sequence was selected from the C terminal of Runx2. Peptide sequence PCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY.
Background The function of Runx2 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 3672180

Accessory Products

  • LinkedIn