discontinued

NBP1-56862 RWDD1 antibody

See related secondary antibodies

Search for all "RWDD1"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse, Rat RWDD1

Product Description for RWDD1

Rabbit anti Human, Mouse, Rat RWDD1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RWDD1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8MT24
Immunogen:
Synthetic peptides corresponding to RWDD1(RWD domain containing 1) The peptide sequence was selected from the middle region of RWDD1. Peptide sequence KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ.
GeneID:
51389
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 51389

Accessory Products

  • LinkedIn