discontinued

NBP1-56954 S100P binding protein antibody

See related secondary antibodies

Search for all "S100P binding protein"

50 µg / €440.00

Quick Overview

Rabbit anti Human S100P binding protein

Product Description for S100P binding protein

Rabbit anti Human S100P binding protein.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for S100P binding protein

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8MTZ6
Immunogen:
Synthetic peptides corresponding to S100PBP(S100P binding protein) The peptide sequence was selected from the middle region of S100PBP. Peptide sequence ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ.
GeneID:
64766
Background The specific function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 64766

Accessory Products

  • LinkedIn