
NBP1-56954 S100P binding protein antibody

See related secondary antibodies

Search for all "S100P binding protein"

Quick Overview

Rabbit anti Human S100P binding protein

Product Description for S100P binding protein

Rabbit anti Human S100P binding protein.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for S100P binding protein

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to S100PBP(S100P binding protein) The peptide sequence was selected from the middle region of S100PBP. Peptide sequence ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ.
Background The specific function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 64766

Accessory Products

  • LinkedIn