discontinued

H00057167-M03 Sal-like protein 4 (SALL4) antibody

See related secondary antibodies

Search for all "Sal-like protein 4 (SALL4)"

Quick Overview

Mouse anti Human, Mouse Sal-like protein 4 (SALL4) 6E3

H00057167-M03

More Views

  • H00057167-M03
  • H00057167-M03
  • H00057167-M03

Product Description for Sal-like protein 4 (SALL4)

Mouse anti Human, Mouse Sal-like protein 4 (SALL4) 6E3.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for Sal-like protein 4 (SALL4)

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Zinc finger protein SALL4
Presentation Purified
Reactivity Hu, Ms
Applications E, P, WB
Clonality Monoclonal
Clone 6E3
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UJQ4
Immunogen:
SALL4 (NP_065169, 954 a.a. ~ 1054 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEK PSATDGVPKHQFPHFLEENKIAVS*
GeneID:
57167
Remarks:
Gene Accession: NM_020436
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant SALL4.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse
Gene ID 57167

Accessory Products

Proteins and/or Positive Controls

Proteins for Sal-like protein 4 (SALL4) (3 products)

Catalog No. Species Pres. Purity   Source  

Sal-like protein 4 (SALL4)

Sal-like protein 4 (SALL4) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Sal-like protein 4 (SALL4)

Sal-like protein 4 (SALL4) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Sal-like protein 4 (SALL4)

Sal-like protein 4 (SALL4) Human
  Abnova Taiwan Corp.

Positive controls for Sal-like protein 4 (SALL4) (1 products)

Catalog No. Species Pres. Purity   Source  

SALL4 overexpression lysate

SALL4 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn