discontinued

NBP1-60113 SAMD8 antibody

See related secondary antibodies

Search for all "SAMD8"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse, Rat, Zebrafish SAMD8

Product Description for SAMD8

Rabbit anti Human, Mouse, Rat, Zebrafish SAMD8.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SAMD8

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5JSC8
Immunogen:
Synthetic peptides corresponding to SAMD8(sterile alpha motif domain containing 8) The peptide sequence was selected from the middle region of SAMD8. Peptide sequence MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL.
GeneID:
142891
Background SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 142891

Accessory Products

  • LinkedIn