discontinued

NBP1-59698 SAP102 antibody

See related secondary antibodies

Search for all "SAP102"

50 µg / €390.00

Quick Overview

Rabbit anti Human, Mouse, Rat SAP102

Product Description for SAP102

Rabbit anti Human, Mouse, Rat SAP102.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SAP102

Product Category Primary Antibodies
Quantity 50 µg
Synonyms KIAA1232, MRX, MRX90, NE-Dlg, NEDLG, SAP102
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5JUW6
Immunogen:
Synthetic peptides corresponding to DLG3(discs, large homolog 3 (neuroendocrine-dlg, Drosophila)) The peptide sequence was selected from the N terminal of DLG3. Peptide sequence HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSG.
GeneID:
1741
Background DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 1741

Accessory Products

  • LinkedIn