TA334565 SAPS1 antibody

Rabbit Polyclonal Anti-PPP6R1 Antibody

See related secondary antibodies

Search for all "SAPS1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat SAPS1

Product Description for SAPS1

Rabbit anti Bovine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat SAPS1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SAPS1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms KIAA1115, PP6R1, SAPS domain family member 1, Serine/threonine-protein phosphatase 6 regulatory subunit 1
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UPN7
Immunogen:
The immunogen for anti-PPP6R1 antibody: synthetic peptide directed towards the N terminal of human PPP6R1. Synthetic peptide located within the following region: MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ.
GeneID:
22870
Application WB
Background Protein phosphatase regulatory subunits, such as SAPS1, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS1 is a regulatory subunit for the protein phosphatase-6 catalytic subunit (PPP6C; MIM 300141) (Stefansson and Brautigan, 2006 [PubMed 16769727]).
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SAPS1 (1 products)

Catalog No. Species Pres. Purity   Source  

SAPS1

SAPS1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Positive controls for SAPS1 (1 products)

Catalog No. Species Pres. Purity   Source  

PPP6R1 overexpression lysate

PPP6R1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn