NBP1-70769 SARDH antibody

See related secondary antibodies

Search for all "SARDH"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat, Zebrafish SARDH

Product Description for SARDH

Rabbit anti Canine, Human, Mouse, Rat, Zebrafish SARDH.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SARDH

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Can, Hu, Ms, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SARDH(sarcosine dehydrogenase) The peptide sequence was selected from the middle region of SARDH. Peptide sequence DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ.
Background The function remains known.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 1757

Accessory Products

Proteins and/or Positive Controls

Positive controls for SARDH (1 products)

Catalog No. Species Pres. Purity   Source  

SARDH overexpression lysate

SARDH overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn