discontinued

NBP1-70769 SARDH antibody

See related secondary antibodies

Search for all "SARDH"

0.1 mg / €360.00

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat, Zebrafish SARDH

Product Description for SARDH

Rabbit anti Canine, Human, Mouse, Rat, Zebrafish SARDH.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SARDH

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Can, Hu, Ms, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UL12
Immunogen:
Synthetic peptides corresponding to SARDH(sarcosine dehydrogenase) The peptide sequence was selected from the middle region of SARDH. Peptide sequence DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ.
GeneID:
1757
Background The function remains known.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified
Gene ID 1757

Accessory Products

Proteins and/or Positive Controls

Positive controls for SARDH (1 products)

Catalog No. Species Pres. Purity   Source  

SARDH overexpression lysate

SARDH overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn