discontinued

H00010066-B01 SCAMP2 antibody

See related secondary antibodies

Search for all "SCAMP2"

Quick Overview

Mouse anti Human SCAMP2

Product Description for SCAMP2

Mouse anti Human SCAMP2.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for SCAMP2

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Secretory carrier membrane protein 2, Secretory carrier-associated membrane protein 2
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O15127
Immunogen:
SCAMP2 (AAH01376, 1 a.a. ~ 330 a.a) full-length human protein.
AA Sequence:
MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQA VVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKML YYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQ IGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQAQEEF SQGIFSSRTFHRAASSAAQGAFQGN*
GeneID:
10066
Remarks:
Gene Accession: BC001376
Add. information Mouse polyclonal antibody raised against a full-length human SCAMP2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 10066

Accessory Products

Proteins and/or Positive Controls

Proteins for SCAMP2 (3 products)

Catalog No. Species Pres. Purity   Source  

SCAMP2

SCAMP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

SCAMP2

SCAMP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SCAMP2

SCAMP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SCAMP2 (3 products)

Catalog No. Species Pres. Purity   Source  

SCAMP2 293T Cell Transient Overexpression Lysate(Denatured)

SCAMP2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SCAMP2 Lysate

Western Blot: SCAMP2 Lysate [NBL1-15711] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SCAMP2
  Novus Biologicals Inc.

SCAMP2 overexpression lysate

SCAMP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn