discontinued

H00000950-A01 SCARB2 antibody

See related secondary antibodies

Search for all "SCARB2"

Quick Overview

Mouse anti Human SCARB2

Product Description for SCARB2

Mouse anti Human SCARB2.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for SCARB2

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms 85 kDa lysosomal membrane sialoglycoprotein, CD36 antigen-like 2, CD36L2, LGP85, LIMP II, LIMP2, LIMPII, Lysosome membrane protein 2, SR-BII, SRB2, Scavenger receptor class B member 2
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14108
Immunogen:
SCARB2 (NP_005497, 339 a.a. ~ 438 a.a) partial recombinant protein with GST tag.
AA Sequence:
FPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNES VHIDKETASRLKSMINTTLIITN*
GeneID:
950
Remarks:
Gene Accession: NM_005506
Add. information Mouse polyclonal antibody raised against a partial recombinant SCARB2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Tr
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 950

Accessory Products

Proteins and/or Positive Controls

Proteins for SCARB2 (6 products)

Catalog No. Species Pres. Purity   Source  

SCARB2

SCARB2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

SCARB2

SCARB2 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

SCARB2

SCARB2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SCARB2

SCARB2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SCARB2

SCARB2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SCARB2

SCARB2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SCARB2 (1 products)

Catalog No. Species Pres. Purity   Source  

SCARB2 293T Cell Transient Overexpression Lysate(Denatured)

SCARB2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn