
NBP1-55451 SCFD1 antibody

See related secondary antibodies

Search for all "SCFD1"

Quick Overview

Rabbit anti Human, Mouse, Rat SCFD1

Product Description for SCFD1

Rabbit anti Human, Mouse, Rat SCFD1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SCFD1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms C14orf163, KIAA0917, RA410, SLY1, STXBP1L2
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SCFD1(sec1 family domain containing 1) The peptide sequence was selected from the N terminal of SCFD1. Peptide sequence SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME.
Background The specific function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 23256

Accessory Products

  • LinkedIn