H00388325-B01P SCIMP antibody

See related secondary antibodies

Search for all "SCIMP"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human SCIMP

H00388325-B01P

Product Description for SCIMP

Mouse anti Human SCIMP.
Product is tested for Western blot / Immunoblot.

Properties for SCIMP

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C17orf87, UNQ5783, UNQ5783/PRO16090
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UWF3
Immunogen:
SCIMP (ADR82817.1, 1 a.a. ~ 145 a.a) full-length human protein.
AA Sequence:
MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKHKQVDEEKMYENVLNES PVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANTEKASF
GeneID:
388325
Add. information Mouse polyclonal antibody raised against a full-length human SCIMP protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for SCIMP (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 17 open reading frame 87 (C17orf87)

Chromosome 17 open reading frame 87 (C17orf87) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for SCIMP (1 products)

Catalog No. Species Pres. Purity   Source  

SCIMP overexpression lysate

SCIMP overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn