discontinued

H00010283-B01P SDCCAG10 / CWC27 antibody

See related secondary antibodies

Search for all "SDCCAG10 / CWC27"

Quick Overview

Mouse anti Human SDCCAG10 / CWC27

H00010283-B01P

More Views

  • H00010283-B01P

Product Description for SDCCAG10 / CWC27

Mouse anti Human SDCCAG10 / CWC27.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for SDCCAG10 / CWC27

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Antigen NY-CO-10, Peptidyl-prolyl cis-trans isomerase CWC27 homolog, Serologically defined colon cancer antigen 10
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UX04
Immunogen:
SDCCAG10 (AAH12117.1, 1 a.a. ~ 291 a.a) full-length human protein.
AA Sequence:
MANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPHKIKSCEVLFNPFDDIIP REIKRLKKEKPEEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEK GDAPDLVDDGEDESAEHDEYIDGDEKNLMRERIAKKLKKDTSANVKSAGEGEVEKKSVSRSEELRKEARQLKRELL AAKQKKVENAAKQAEKRSEEEEAPPDGAVAEYRREKQKYEALRKQQSKKGTSREDQDVTCTSV
GeneID:
10283
Remarks:
Gene Accession: BC012117
Add. information Mouse polyclonal antibody raised against a full-length human SDCCAG10 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10283

Accessory Products

Proteins and/or Positive Controls

Proteins for SDCCAG10 / CWC27 (2 products)

Catalog No. Species Pres. Purity   Source  

SDCCAG10 / CWC27

SDCCAG10 / CWC27 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SDCCAG10 / CWC27

SDCCAG10 / CWC27 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SDCCAG10 / CWC27 (2 products)

Catalog No. Species Pres. Purity   Source  

CWC27 overexpression lysate

CWC27 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

SDCCAG10 293T Cell Transient Overexpression Lysate(Denatured)

SDCCAG10 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn