
NBP1-69311 SDF4 antibody

See related secondary antibodies

Search for all "SDF4"

Quick Overview

Rabbit anti Human, Mouse, Rat SDF4

Product Description for SDF4

Rabbit anti Human, Mouse, Rat SDF4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SDF4

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SDF4(stromal cell derived factor 4) The peptide sequence was selected from the C terminal of SDF4. Peptide sequence KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA.
Background SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 51150

Accessory Products

  • LinkedIn