discontinued

NBP1-69587 SDF4 antibody

See related secondary antibodies

Search for all "SDF4"

50 µg / €390.00

Quick Overview

Rabbit anti Human SDF4

Product Description for SDF4

Rabbit anti Human SDF4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SDF4

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B1AME6
Immunogen:
Synthetic peptides corresponding to SDF4(stromal cell derived factor 4) The peptide sequence was selected from the middle region of SDF4. Peptide sequence KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEE.
GeneID:
51150
Background SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 51150

Accessory Products

  • LinkedIn