
NBP1-55112 Sec8 antibody

See related secondary antibodies

Search for all "Sec8"

Quick Overview

Rabbit anti Human, Mouse, Rat Sec8

Product Description for Sec8

Rabbit anti Human, Mouse, Rat Sec8.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Sec8

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC27170, REC8, SEC8, SEC8L1, Sec8p
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to EXOC4(exocyst complex component 4) The peptide sequence was selected from the N terminal of EXOC4. Peptide sequence MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA.
Background The specific function of this protein remains unknown.The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn