NBP1-69276 SEMA4B antibody

See related secondary antibodies

Search for all "SEMA4B"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat SEMA4B

Product Description for SEMA4B

Rabbit anti Human, Mouse, Rat SEMA4B.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SEMA4B

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2NL81
Immunogen:
Synthetic peptides corresponding to SEMA4B(sema domain, immunoglobulin domain (Ig), (semaphorin) 4B) The peptide sequence was selected from the N terminal of SEMA4B. Peptide sequence KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS.
Background SEMA4B is a single-pass type I membrane protein. It belongs to the semaphorin family. SEMA4B contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn