
NBP1-69276 SEMA4B antibody

See related secondary antibodies

Search for all "SEMA4B"

Quick Overview

Rabbit anti Human, Mouse, Rat SEMA4B

Product Description for SEMA4B

Rabbit anti Human, Mouse, Rat SEMA4B.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SEMA4B

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SEMA4B(sema domain, immunoglobulin domain (Ig), (semaphorin) 4B) The peptide sequence was selected from the N terminal of SEMA4B. Peptide sequence KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS.
Background SEMA4B is a single-pass type I membrane protein. It belongs to the semaphorin family. SEMA4B contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn