discontinued

H00205564-M01 SENP5 antibody

See related secondary antibodies

Search for all "SENP5"

Quick Overview

Mouse anti Human SENP5 3C2

Product Description for SENP5

Mouse anti Human SENP5 3C2.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for SENP5

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Sentrin-specific protease 5, Sentrin/SUMO-specific protease SENP5
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3C2
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96HI0
Immunogen:
SENP5 (NP_689912, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
KKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTWNRQLRHFQGRKKALQIQKTWIKDEHLC AKTKFNVATQNVSTLSSKVKRKDAKHFISSSK*
GeneID:
205564
Remarks:
Gene Accession: NM_152699
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant SENP5.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 205564

Accessory Products

Proteins and/or Positive Controls

Proteins for SENP5 (5 products)

Catalog No. Species Pres. Purity   Source  

SENP5

SENP5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SENP5

SENP5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SENP5

SENP5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SENP5

SENP5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SENP5

SENP5 Human
  Abnova Taiwan Corp.

Positive controls for SENP5 (2 products)

Catalog No. Species Pres. Purity   Source  

SENP5 Lysate

Western Blot: SENP5 Lysate [NBL1-15811] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SENP5
  Novus Biologicals Inc.

SENP5 overexpression lysate

SENP5 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn