NBP1-92378 Sentan / SNTN antibody

See related secondary antibodies

Search for all "Sentan / SNTN"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Sentan / SNTN

NBP1-92378

More Views

  • NBP1-92378

Product Description for Sentan / SNTN

Rabbit anti Human Sentan / SNTN.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Sentan / SNTN

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms S100 calcium-binding protein A1-like, S100-A1-like, S100A1L
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NMZ2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: HSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNSSDSDGKLE
GeneID:
132203
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 132203

Accessory Products

Proteins and/or Positive Controls

Proteins for Sentan / SNTN (4 products)

Catalog No. Species Pres. Purity   Source  

Sentan, cilia apical structure protein (SNTN)

Sentan, cilia apical structure protein (SNTN) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Sentan / SNTN (1-147, His-tag)

Sentan / SNTN Human Purified > 90 % E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

Sentan / SNTN (1-147, His-tag)

Sentan / SNTN Human Purified > 90 % E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

SNTN

SNTN Human
0.1 mg / €380.00
  Abnova Taiwan Corp.

Positive controls for Sentan / SNTN (1 products)

Catalog No. Species Pres. Purity   Source  

SNTN overexpression lysate

SNTN overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn