NBP1-69058 SEPN1 antibody

See related secondary antibodies

Search for all "SEPN1"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse SEPN1


Product Description for SEPN1

Rabbit anti Mouse SEPN1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SEPN1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to Sepn1 (selenoprotein N, 1) The peptide sequence was selected from the C terminal of Sepn1. Peptide sequence VHHINANYFLDITSMKPEDMENNNVFSFSSSFEDPSTATYMQFLREGLRR.
Background The function of Sepn1 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 7477700

Accessory Products

  • LinkedIn