
NBP1-59365 SERCA1 ATPase antibody

See related secondary antibodies

Search for all "SERCA1 ATPase"

Quick Overview

Rabbit anti Human SERCA1 ATPase

Product Description for SERCA1 ATPase

Rabbit anti Human SERCA1 ATPase.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SERCA1 ATPase

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ATP2A1(ATPase, Ca++ transporting, cardiac muscle, fast twitch 1) The peptide sequence was selected from the N terminal of ATP2A1. Peptide sequence MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW.
Background This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn