TA329996 Serotonin receptor 3A (HTR3A) antibody

Rabbit Polyclonal Anti-HTR3A Antibody

See related secondary antibodies

Search for all "Serotonin receptor 3A (HTR3A)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Serotonin receptor 3A (HTR3A)


More Views

  • TA329996

Product Description for Serotonin receptor 3A (HTR3A)

Rabbit anti Human Serotonin receptor 3A (HTR3A).
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Serotonin receptor 3A (HTR3A)

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms 5-HT3A, 5-HT3R, 5-hydroxytryptamine receptor 3A, Serotonin-gated ion channel receptor
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-HTR3A antibody: synthetic peptide directed towards the N terminal of human HTR3A. Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV.
Application WB
Background HTR3A belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combition of A and B subunits is necessary to provide the full functiol features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Altertively spliced transcript variants encoding different isoforms have been identified.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Serotonin receptor 3A (HTR3A) (1 products)

Catalog No. Species Pres. Purity   Source  

Serotonin receptor 3A (HTR3A)

Serotonin receptor 3A (HTR3A) Human
  Abnova Taiwan Corp.

Positive controls for Serotonin receptor 3A (HTR3A) (2 products)

Catalog No. Species Pres. Purity   Source  

5HT3A receptor Lysate

Western Blot: 5HT3A receptor Lysate [NBL1-11779] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HTR3A
  Novus Biologicals Inc.

HTR3A overexpression lysate

HTR3A overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn