discontinued

H00008710-B01 SERPINB7 antibody

See related secondary antibodies

Search for all "SERPINB7"

Quick Overview

Mouse anti Human SERPINB7

Product Description for SERPINB7

Mouse anti Human SERPINB7.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for SERPINB7

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Megsin, Serpin B7
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O75635
Immunogen:
SERPINB7 (NP_003775.1, 1 a.a. ~ 380 a.a) full-length human protein.
AA Sequence:
MASLAAANAEFCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSSNSQSGL QSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEKLYDAKVERVDFTNHLEDTRRNINKWVENETHG KIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCHFKSPKCSGKAVAMMHQERKFNLSVIEDPSMKILE LRYNGGINMYVLLPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESK ADLSGIASGGRLYISRMMHKSYIEVTEEGTEATAATGSNIVEKQLPQSTLFRADHPFLFVIRKDDIILFSGKVSCP
GeneID:
8710
Remarks:
Gene Accession: NM_003784.2
Add. information Mouse polyclonal antibody raised against a full-length human SERPINB7 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 8710

Accessory Products

Proteins and/or Positive Controls

Proteins for SERPINB7 (2 products)

Catalog No. Species Pres. Purity   Source  

SERPINB7

SERPINB7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SERPINB7

SERPINB7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SERPINB7 (3 products)

Catalog No. Species Pres. Purity   Source  

SERPINB7 293T Cell Transient Overexpression Lysate(Denatured)

SERPINB7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SERPINB7 overexpression lysate

SERPINB7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SERPINB7 overexpression lysate

SERPINB7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn