discontinued

H00006288-M01 Serum Amyloid A protein (SAA) antibody

See related secondary antibodies

Search for all "Serum Amyloid A protein (SAA)"

Quick Overview

Mouse anti Human Serum Amyloid A protein (SAA) 3C11-2C1

H00006288-M01

More Views

  • H00006288-M01

Product Description for Serum Amyloid A protein (SAA)

Mouse anti Human Serum Amyloid A protein (SAA) 3C11-2C1.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for Serum Amyloid A protein (SAA)

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms SAA1, SAA2
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 3C11-2C1
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P02735
Immunogen:
SAA1 (AAH07022, 1 a.a. ~ 123 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAI SDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY*
GeneID:
6288
Remarks:
Gene Accession: BC007022
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a full length recombinant SAA1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,WB-Re,WB-Ti
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 6289

Accessory Products

Proteins and/or Positive Controls

Proteins for Serum Amyloid A protein (SAA) (15 products)

Catalog No. Species Pres. Purity   Source  

Serum Amyloid A protein (SAA) (19-122, His-tag)

Recombinant human Serum amyloid A, 19-122 aa, His-tagged Human Purified > 95 % pure by SDS-PAGE E. coli
0.5 mg / €540.00
  Acris Antibodies GmbH

Serum Amyloid A protein (SAA) (19-122, His-tag)

Recombinant human Serum amyloid A, 19-122 aa, His-tagged Human Purified > 95 % pure by SDS-PAGE E. coli
0.1 mg / €230.00
  Acris Antibodies GmbH

Serum Amyloid A protein (SAA) (Apo-SAA1)

Serum Amyloid A protein (SAA) Human > 98 % pure by SDS-PAGE and HPLC analyses E. coli
  Acris Antibodies GmbH

Serum Amyloid A protein (SAA) (Apo-SAA1)

Serum Amyloid A protein (SAA) Human > 98 % pure by SDS-PAGE and HPLC analyses E. coli
  Acris Antibodies GmbH

Serum Amyloid A protein (SAA)

Serum Amyloid A protein (SAA) Human > 98 % Greater than 98% by SDS-PAGE gel and HPLC analyses E. coli
  Acris Antibodies GmbH

Serum Amyloid A protein (SAA) (SAA1)

Serum Amyloid A protein (SAA) Human in vitro transl.
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA) (SAA1)

Serum Amyloid A protein (SAA) Human in vitro transl.
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA)

Serum Amyloid A protein (SAA) Human
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA)

Serum Amyloid A protein (SAA) Human
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA) (SAA2)

Serum Amyloid A protein (SAA) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA) (SAA2)

Serum Amyloid A protein (SAA) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA)

Serum Amyloid A protein (SAA) Human
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA)

Serum Amyloid A protein (SAA) Human > 96 % Serum
  BBI Solutions

Serum Amyloid A protein (SAA)

SDS-Page: Serum Amyloid A Protein [NBP1-30209] - Serum amyloid A, 13.9 kDa (125aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Human Purified
  Novus Biologicals Inc.

Serum Amyloid A protein (SAA)

Serum Amyloid A protein (SAA) Human Purified
  Novus Biologicals Inc.

Positive controls for Serum Amyloid A protein (SAA) (3 products)

Catalog No. Species Pres. Purity   Source  

SAA2 Lysate (SAA2)

Western Blot: SAA2 Lysate [NBL1-15672] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SAA2
  Novus Biologicals Inc.

Serum Amyloid A Lysate

Western Blot: Serum Amyloid A Lysate [NBL1-15670] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SAA1
  Novus Biologicals Inc.

Serum Amyloid A Lysate

Western Blot: Serum Amyloid A Lysate [NBL1-15671] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SAA1
  Novus Biologicals Inc.
  • LinkedIn