discontinued

H00006289-D01P Serum Amyloid A protein (SAA) (SAA2) antibody

See related secondary antibodies

Search for all "Serum Amyloid A protein (SAA)"

Quick Overview

Rabbit anti Human Serum Amyloid A protein (SAA)

Product Description for Serum Amyloid A protein (SAA)

Rabbit anti Human Serum Amyloid A protein (SAA).
Properties: (SAA2)
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Serum Amyloid A protein (SAA)

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms SAA1, SAA2
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P02735
Immunogen:
SAA2 (NP_110381.1, 1 a.a. ~ 67 a.a) full-length human protein.
AA Sequence:
MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVI SNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
GeneID:
6288
Remarks:
Gene Accession: NM_030754
Property SAA2
Add. information Rabbit polyclonal antibody raised against a full-length human SAA2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 6288

Accessory Products

Proteins and/or Positive Controls

Proteins for Serum Amyloid A protein (SAA) (15 products)

Catalog No. Species Pres. Purity   Source  

Serum Amyloid A protein (SAA) (19-122, His-tag)

Recombinant human Serum amyloid A, 19-122 aa, His-tagged Human Purified > 95 % pure by SDS-PAGE E. coli
0.5 mg / €540.00
  Acris Antibodies GmbH

Serum Amyloid A protein (SAA) (19-122, His-tag)

Recombinant human Serum amyloid A, 19-122 aa, His-tagged Human Purified > 95 % pure by SDS-PAGE E. coli
0.1 mg / €230.00
  Acris Antibodies GmbH

Serum Amyloid A protein (SAA) (Apo-SAA1)

Serum Amyloid A protein (SAA) Human > 98 % pure by SDS-PAGE and HPLC analyses E. coli
  Acris Antibodies GmbH

Serum Amyloid A protein (SAA) (Apo-SAA1)

Serum Amyloid A protein (SAA) Human > 98 % pure by SDS-PAGE and HPLC analyses E. coli
  Acris Antibodies GmbH

Serum Amyloid A protein (SAA)

Serum Amyloid A protein (SAA) Human > 98 % Greater than 98% by SDS-PAGE gel and HPLC analyses E. coli
  Acris Antibodies GmbH

Serum Amyloid A protein (SAA) (SAA1)

Serum Amyloid A protein (SAA) Human in vitro transl.
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA) (SAA1)

Serum Amyloid A protein (SAA) Human in vitro transl.
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA)

Serum Amyloid A protein (SAA) Human
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA)

Serum Amyloid A protein (SAA) Human
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA) (SAA2)

Serum Amyloid A protein (SAA) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA) (SAA2)

Serum Amyloid A protein (SAA) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA)

Serum Amyloid A protein (SAA) Human
  Abnova Taiwan Corp.

Serum Amyloid A protein (SAA)

Serum Amyloid A protein (SAA) Human > 96 % Serum
  BBI Solutions

Serum Amyloid A protein (SAA)

SDS-Page: Serum Amyloid A Protein [NBP1-30209] - Serum amyloid A, 13.9 kDa (125aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Human Purified
  Novus Biologicals Inc.

Serum Amyloid A protein (SAA)

Serum Amyloid A protein (SAA) Human Purified
  Novus Biologicals Inc.

Positive controls for Serum Amyloid A protein (SAA) (3 products)

Catalog No. Species Pres. Purity   Source  

SAA2 Lysate (SAA2)

Western Blot: SAA2 Lysate [NBL1-15672] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SAA2
  Novus Biologicals Inc.

Serum Amyloid A Lysate

Western Blot: Serum Amyloid A Lysate [NBL1-15670] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SAA1
  Novus Biologicals Inc.

Serum Amyloid A Lysate

Western Blot: Serum Amyloid A Lysate [NBL1-15671] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SAA1
  Novus Biologicals Inc.
  • LinkedIn