NBP1-58201 SET antibody

See related secondary antibodies

Search for all "SET"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat SET

Product Description for SET

Rabbit anti Human, Mouse, Rat SET.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for SET

Product Category Primary Antibodies
Quantity 50 µg
Synonyms 2PP2A, I2PP2A, IGAAD, PHAPII, TAF-IBETA
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications ICC/IF, P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B2RCX0
Immunogen:
Synthetic peptides corresponding to SET(SET nuclear oncogene) The peptide sequence was selected from the N terminal of SET. Peptide sequence IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT.
Background SET is a multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-indu
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn