discontinued

NBP1-58201 SET antibody

See related secondary antibodies

Search for all "SET"

Quick Overview

Rabbit anti Human, Mouse, Rat SET

Product Description for SET

Rabbit anti Human, Mouse, Rat SET.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for SET

Product Category Primary Antibodies
Quantity 50 µg
Synonyms 2PP2A, I2PP2A, IGAAD, PHAPII, TAF-IBETA
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications ICC/IF, P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B2RCX0
Immunogen:
Synthetic peptides corresponding to SET(SET nuclear oncogene) The peptide sequence was selected from the N terminal of SET. Peptide sequence IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT.
Background SET is a multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-indu
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn