NBP1-92380 SF3B2 antibody

See related secondary antibodies

Search for all "SF3B2"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SF3B2

NBP1-92380

More Views

  • NBP1-92380

Product Description for SF3B2

Rabbit anti Human SF3B2.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections.

Properties for SF3B2

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications ICC/IF, P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13435
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFK
GeneID:
10992
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 10992

Accessory Products

Proteins and/or Positive Controls

Proteins for SF3B2 (1 products)

Catalog No. Species Pres. Purity   Source  

Splicing factor 3b, subunit 2, 145kDa (SF3B2)

Splicing factor 3b, subunit 2, 145kDa (SF3B2) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for SF3B2 (1 products)

Catalog No. Species Pres. Purity   Source  

SF3B2 overexpression lysate

SF3B2 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn