NBP1-59728 SFXN3 antibody

See related secondary antibodies

Search for all "SFXN3"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat SFXN3

Product Description for SFXN3

Rabbit anti Human, Mouse, Rat SFXN3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SFXN3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms BA108L7.2, SFX3
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SFXN3(sideroflexin 3) The peptide sequence was selected from the middle region of SFXN3. Peptide sequence TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN.
Background SFXN3 is a potential iron transporter.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn