discontinued

NBP1-59728 SFXN3 antibody

See related secondary antibodies

Search for all "SFXN3"

Quick Overview

Rabbit anti Human, Mouse, Rat SFXN3

Product Description for SFXN3

Rabbit anti Human, Mouse, Rat SFXN3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SFXN3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms BA108L7.2, SFX3
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NCZ6
Immunogen:
Synthetic peptides corresponding to SFXN3(sideroflexin 3) The peptide sequence was selected from the middle region of SFXN3. Peptide sequence TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN.
Background SFXN3 is a potential iron transporter.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn