NBP1-58912 SGK3 antibody

See related secondary antibodies

Search for all "SGK3"

50 µg / €390.00

Quick Overview

Rabbit anti Human SGK3

Product Description for SGK3

Rabbit anti Human SGK3.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SGK3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CISK, DKFZp781N0293, SGK2, SGKL
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SGK3(serum/glucocorticoid regulated kinase family, member 3) The peptide sequence was selected from the N terminal of SGK3. Peptide sequence LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH.
Background The specific function of the protein remains unknown.This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 23678

Accessory Products

  • LinkedIn