NBP1-57065 SH3KBP1 antibody

See related secondary antibodies

Search for all "SH3KBP1"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SH3KBP1

NBP1-57065

Product Description for SH3KBP1

Rabbit anti Human SH3KBP1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SH3KBP1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5JPT5
Immunogen:
Synthetic peptides corresponding to SH3KBP1 (SH3-domain kinase binding protein 1) The peptide sequence was selected from the N terminal of SH3KBP1. Peptide sequence TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS.
GeneID:
30011
Background This gene encodes an adapter protein that contains three N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 30011

Accessory Products

  • LinkedIn