NBP1-94182 SHF antibody

See related secondary antibodies

Search for all "SHF"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SHF

Product Description for SHF

Rabbit anti Human SHF.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for SHF

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B3KTY1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DIKVIKDLPWPPPVGQLDSSPSLPDGDRDISGPASPLPEPSLEDSSAQFEGPEKSCLSPGREEKGRLPPRLSAGNPKSAKPLSMEPS
GeneID:
90525
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 90525

Accessory Products

Proteins and/or Positive Controls

Proteins for SHF (1 products)

Catalog No. Species Pres. Purity   Source  

Src homology 2 domain containing F (SHF)

Src homology 2 domain containing F (SHF) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for SHF (1 products)

Catalog No. Species Pres. Purity   Source  

SHF overexpression lysate

SHF overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn