
NBP1-52833 SIRT5 antibody

See related secondary antibodies

Search for all "SIRT5"

Quick Overview

Rabbit anti Human SIRT5


Product Description for SIRT5

Rabbit anti Human SIRT5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SIRT5

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SIRT5 (sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)) The peptide sequence was selected from the C terminal of SIRT5 . Peptide sequence HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAE
Background SIRT5 is included in class III of the sirtuin family which ischaracterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 23408

Accessory Products

  • LinkedIn