TA338237 Skeletal muscle Troponin C antibody

Rabbit Polyclonal Anti-TNNC2 Antibody

See related secondary antibodies

Search for all "Skeletal muscle Troponin C"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish Skeletal muscle Troponin C

Product Description for Skeletal muscle Troponin C

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish Skeletal muscle Troponin C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Skeletal muscle Troponin C

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms TNNC2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P02585
Immunogen:
The immunogen for anti-TNNC2 antibody is: synthetic peptide directed towards the N-terminal region of Human TNNC2. Synthetic peptide located within the following region: ISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQM.
GeneID:
7125
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Skeletal muscle Troponin C (6 products)

Catalog No. Species Pres. Purity   Source  

Skeletal muscle Troponin C

Skeletal muscle Troponin C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Skeletal muscle Troponin C (full length, C-term DDK tag)

Skeletal muscle Troponin C Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €399.00
  OriGene Technologies, Inc.

Skeletal muscle Troponin C (1-160)

Skeletal muscle Troponin C Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €750.00
  OriGene Technologies GmbH

Skeletal muscle Troponin C (1-160)

Skeletal muscle Troponin C Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

Skeletal muscle Troponin C

Skeletal muscle Troponin C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Skeletal muscle Troponin C

Skeletal muscle Troponin C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Skeletal muscle Troponin C (2 products)

Catalog No. Species Pres. Purity   Source  

TNNC2 Lysate

Western Blot: TNNC2 Lysate [NBL1-17177] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TNNC2
  Novus Biologicals Inc.

TNNC2 overexpression lysate

TNNC2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn