NBP1-52966 Slap antibody

See related secondary antibodies

Search for all "Slap"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Slap

Product Description for Slap

Rabbit anti Human Slap.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Slap

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5TZW1
Immunogen:
Synthetic peptides corresponding to SLA(Src-like-adaptor) The peptide sequence was selected from the middle region of SLA. Peptide sequence PEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGG.
Background SLA is an adapter protein, which negatively regulates T-cell receptor (TCR) signaling. SLA inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. SLA is involved in the negative regulation of positive selection and mit
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn