
NBP1-57622 SLC12A1 antibody

See related secondary antibodies

Search for all "SLC12A1"

50 µg / €440.00

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat SLC12A1

Product Description for SLC12A1

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat SLC12A1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SLC12A1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Bov, Can, Chk, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SLC12A1(solute carrier family 12 (sodium/potassium/chloride transporters), member 1) The peptide sequence was selected from the N terminal of SLC12A1. Peptide sequence NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFA
Background The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 6557

Accessory Products

  • LinkedIn