TA334636 SLC16A12 antibody

Rabbit Polyclonal Anti-SLC16A12 Antibody

See related secondary antibodies

Search for all "SLC16A12"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat SLC16A12

Product Description for SLC16A12

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat SLC16A12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC16A12

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms MCT 12, MCT12, Monocarboxylate transporter 12, Solute carrier family 16 member 12
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-SLC16A12 antibody: synthetic peptide directed towards the N terminal of human SLC16A12. Synthetic peptide located within the following region: WMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVT.
Application WB
Background As a proton-linked monocarboxylate transporter, SLC16A12 catalyzes the rapid transport across the plasma membrane of many monocarboxylates.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn