
NBP1-59732 SLC1A5 antibody

See related secondary antibodies

Search for all "SLC1A5"

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat, Xenopus, Zebrafish SLC1A5

Product Description for SLC1A5

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat, Xenopus, Zebrafish SLC1A5.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SLC1A5

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Bov, Can, Chk, Hu, Ms, Rb, Rt, Xen, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SLC1A5(solute carrier family 1 (neutral amino acid transporter), member 5) The peptide sequence was selected from the middle region of SLC1A5. Peptide sequence FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMF
Background SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. It acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.

Accessory Products

  • LinkedIn