TA333740 SLC22A17 antibody

Rabbit Polyclonal Anti-SLC22A17 Antibody

See related secondary antibodies

Search for all "SLC22A17"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SLC22A17

Product Description for SLC22A17

Rabbit anti Human SLC22A17.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC22A17

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BOCT, BOIT, Brain-type organic cation transporter, Solute carrier family 22 member 17
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-SLC22A17 Antibody: synthetic peptide directed towards the middle region of human SLC22A17. Synthetic peptide located within the following region: HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM.
Application WB
Background The specific functin of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC22A17 (3 products)

Catalog No. Species Pres. Purity   Source  


SLC22A17 Human in vitro transl.
  Abnova Taiwan Corp.


SLC22A17 Human in vitro transl.
  Abnova Taiwan Corp.


SLC22A17 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SLC22A17 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC22A17 overexpression lysate

SLC22A17 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn