
NBP1-56814 SLC22A24 antibody

See related secondary antibodies

Search for all "SLC22A24"

50 µg / €440.00

Quick Overview

Rabbit anti Human SLC22A24

Product Description for SLC22A24

Rabbit anti Human SLC22A24.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC22A24

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to MGC34821 The peptide sequence was selected from the middle region of MGC34821. Peptide sequence VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF.
Background The specific function of this protein remains unknown
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn