TA333465 SLC24A4 antibody

Rabbit Polyclonal Anti-SLC24A4 Antibody

See related secondary antibodies

Search for all "SLC24A4"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SLC24A4

Product Description for SLC24A4

Rabbit anti Human SLC24A4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC24A4

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms NCKX4, Na(+)/K(+)/Ca(2+)-exchange protein 4, Sodium/potassium/calcium exchanger 4, Solute carrier family 24 member 4
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NFF2
Immunogen:
The immunogen for Anti-SLC24A4 Antibody: synthetic peptide directed towards the N terminal of human SLC24A4. Synthetic peptide located within the following region: PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTI.
GeneID:
123041
Application WB
Background Potassium-dependent sodium/calcium exchangers, such as NCKX4, are thought to transport 1 intracellular calcium and 1 potassium ion in exchange for 4 extracellular sodium ions (Li et al., 2002 [PubMed 12379639]).
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC24A4 (2 products)

Catalog No. Species Pres. Purity   Source  

SLC24A4

SLC24A4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SLC24A4

SLC24A4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn