TA337957 SLC25A2 / ORNT2 antibody

Rabbit Polyclonal Anti-SLC25A2 Antibody

See related secondary antibodies

Search for all "SLC25A2 / ORNT2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep SLC25A2 / ORNT2

Product Description for SLC25A2 / ORNT2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep SLC25A2 / ORNT2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC25A2 / ORNT2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Mitochondrial ornithine transporter 2, Solute carrier family 25 member 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BXI2
Immunogen:
The immunogen for anti-SLC25A2 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC25A2. Synthetic peptide located within the following region: VPGYFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWLVVFPV.
GeneID:
83884
Application WB
Background SLC25A2 is located between the protocadherin beta and gamma gene clusters on chromosome 5, this intronless gene encodes a protein that is highly similar to an ornithine transporter localized in the mitochondrial inner membrane. The encoded protein most likely plays a role in metabolism as a mitochondrial transport protein.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SLC25A2 / ORNT2 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC25A2 overexpression lysate

SLC25A2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn