TA340406 SLC25A48 antibody

Rabbit Polyclonal Anti-SLC25A48 Antibody

See related secondary antibodies

Search for all "SLC25A48"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SLC25A48

Product Description for SLC25A48

Rabbit anti Human SLC25A48.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC25A48

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Solute carrier family 25 member 48
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-SLC25A48 antibody: synthetic peptide directed towards the c terminal of human LOC153328. Synthetic peptide located within the following region: TAVGQLGNCHALLSPGGGQDTFRYSPNNSLLGTYSVPGPLPPQSHPFPMQ.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn