TA333710 SLC26A1 / SAT1 antibody

Rabbit Polyclonal Anti-SLC26A1 Antibody

See related secondary antibodies

Search for all "SLC26A1 / SAT1"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SLC26A1 / SAT1

TA333710

More Views

  • TA333710

Product Description for SLC26A1 / SAT1

Rabbit anti Human SLC26A1 / SAT1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SLC26A1 / SAT1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms SAT-1, Solute carrier family 26 member 1, Sulfate anion transporter 1
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H2B4
Immunogen:
The immunogen for Anti-SLC26A1 Antibody: synthetic peptide directed towards the C terminal of human SLC26A1. Synthetic peptide located within the following region: LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA.
GeneID:
10861
Application WB
IHC
Background SLC26A1 is a member of sulfate/anion transporter family. Family members are well conserved in their protein (aa length among species) structures, but have markedly different tissue expression patterns. Its gene is primarily expressed in the liver, pancreas, and brain.This gene is a member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures, but have markedly different tissue expression patterns. This gene is primarily expressed in the liver, pancreas, and brain. Three splice variants that encode different isoforms have been identified.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SLC26A1 / SAT1 (2 products)

Catalog No. Species Pres. Purity   Source  

SLC26A1 overexpression lysate

SLC26A1 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.

SLC26A1 overexpression lysate

SLC26A1 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn